PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015886622.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family Dof
Protein Properties Length: 314aa    MW: 34625.1 Da    PI: 8.9117
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015886622.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.21e-393191262
          zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                    k++al+cprC+stntkfCyynnyslsqPryfCk+CrryWt+GG+lrnvPvGgg+rknk+ss
  XP_015886622.1 31 KDQALNCPRCNSTNTKFCYYNNYSLSQPRYFCKTCRRYWTEGGSLRNVPVGGGSRKNKRSS 91
                    7899******************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-292789IPR003851Zinc finger, Dof-type
PfamPF027017.0E-343289IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.2643589IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103773IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MDTAQWPQGI GVIKPMEGSR PMLERRTRPQ KDQALNCPRC NSTNTKFCYY NNYSLSQPRY  60
FCKTCRRYWT EGGSLRNVPV GGGSRKNKRS STTSTSTSSP SSAAKKLAHH LHDHDHIHHH  120
LNTPSSTFPQ SASQNPKIHH GQDLNLAYPP SDQDYDGISR FVEVPYTTTT TTTHDQNKSQ  180
SHHHQNPNSS ISSTSSPFSA MELLKTGIIA SRGLNSFINP MSVVPNSNTM FPTGFPMQEF  240
KPSLNFGLDG FENGYGGLNG VQETSARLLF PNEELKQVSG NATTTATTTE FDQQNRGQGD  300
SGGYWTGMLG GGSW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4881313e-58AM488131.2 Vitis vinifera contig VV78X232223.4, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015886622.10.0PREDICTED: dof zinc finger protein DOF4.6-like
TrEMBLA0A0S3REK81e-128A0A0S3REK8_PHAAN; Uncharacterized protein
TrEMBLV7ASA71e-128V7ASA7_PHAVU; Uncharacterized protein
STRINGVIT_16s0098g01420.t011e-127(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67434137
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61850.43e-44Dof family protein